PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g13790.3
Common NameLR48_Vigan02g137100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ERF
Protein Properties Length: 143aa    MW: 15926.9 Da    PI: 6.6702
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g13790.3genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP235.72.2e-1115521756
             AP2 17 AeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56
                    AeIrd + ng  +r++lg+f +ae Aa a+++a+ +++g+
  Vang06g13790.3 15 AEIRDTTRNG--TRVWLGTFESAEAAALAYDQAAFSMRGH 52
                    9****54465..**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5103215.646159IPR001471AP2/ERF domain
SMARTSM003801.8E-19865IPR001471AP2/ERF domain
SuperFamilySSF541715.69E-151460IPR016177DNA-binding domain
Gene3DG3DSA:3.30.730.101.5E-201560IPR001471AP2/ERF domain
PfamPF008476.7E-71952IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MRSYTYYHSF TSDSAEIRDT TRNGTRVWLG TFESAEAAAL AYDQAAFSMR GHNAVLNFPV  60
KRVKESLQEI QYTCFSGSSP ALALKERHCI LRKVSSQAKK CKGKHPSEDP TPSLLVLEDL  120
GVEYLEHLLS ISDQSESPSF FD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gcc_A7e-1914611562ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR 1
3gcc_A8e-1914611865ATERF1
2gcc_A8e-1914611865ATERF1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014511606.17e-71PREDICTED: ethylene-responsive transcription factor 1B-like
SwissprotQ8LDC83e-41ERF92_ARATH; Ethylene-responsive transcription factor 1B
TrEMBLA0A0L9TXJ11e-103A0A0L9TXJ1_PHAAN; Uncharacterized protein
STRINGGLYMA13G18370.29e-67(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF31133199
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23240.14e-33ethylene response factor 1
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]